PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv2_028580_zsnk.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 184aa    MW: 21454.8 Da    PI: 5.0709
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv2_028580_zsnk.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.78.3e-1682139562
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L+++l++ ++  +++ +e
  Bv2_028580_zsnk.t1  82 RKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHVTESHDRVLQE 139
                         689*********************************************9998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1478142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.57680143IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-1282155No hitNo description
SuperFamilySSF579598.13E-1482132No hitNo description
PfamPF001701.4E-1382140IPR004827Basic-leucine zipper domain
CDDcd147023.16E-1883134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MQSNEVTGLQ YLAPSNQSPY PYFPGMAQND ISPLQINKYT NLLYNLQIGS QLQEFTPHPS  60
CFSSNSTSDE ADEQQLTIIN ERKQRRMISN RESARRSRMR KQRHLDELWS QVVWLRNENH  120
QLIDKLNHVT ESHDRVLQEN VQLKEETSEL RQMVTDMQLS SPYSTLRDLE EVANAAYLGE  180
ESPN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694542.11e-135PREDICTED: basic leucine zipper 43
SwissprotQ9FMC26e-50BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0J8CYA11e-135A0A0J8CYA1_BETVU; Uncharacterized protein
STRINGVIT_14s0083g00700.t012e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.16e-57basic leucine-zipper 42